Lineage for d3whxb1 (3whx B:1-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513200Domain d3whxb1: 3whx B:1-112 [259632]
    Other proteins in same PDB: d3whxb2
    automated match to d2ok0l1
    complexed with xpg

Details for d3whxb1

PDB Entry: 3whx (more details), 1.7 Å

PDB Description: Crystal structure of anti-prostaglandin E2 Fab fragment PGE1 complex
PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3whxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3whxb1 b.1.1.1 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgiyyclqgshvpltfgagttlelk

SCOPe Domain Coordinates for d3whxb1:

Click to download the PDB-style file with coordinates for d3whxb1.
(The format of our PDB-style files is described here.)

Timeline for d3whxb1: