Lineage for d3wu2t_ (3wu2 T:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958492Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 1958493Family f.23.34.1: PsbT-like [161030] (1 protein)
    Pfam PF01405
  6. 1958494Protein Photosystem II reaction center protein T, PsbT [161031] (2 species)
  7. 1958500Species Thermosynechococcus vulcanus [TaxId:32053] [224949] (3 PDB entries)
  8. 1958501Domain d3wu2t_: 3wu2 T: [259626]
    Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
    automated match to d2axtt1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2t_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d3wu2t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2t_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus vulcanus [TaxId: 32053]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d3wu2t_:

Click to download the PDB-style file with coordinates for d3wu2t_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2t_: