SCOPe 2.05: Domain d3wu2l_: 3wu2 L:

Lineage for d3wu2l_ (3wu2 L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (5 PDB entries)

8. Domain d3wu2l_: 3wu2 L: [259625]
   Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
   automated match to d2axtl1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2l_

PDB Entry: 3wu2, 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3wu2l_:

Sequence; same for both SEQRES and ATOM records:

>d3wu2l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d3wu2l_:

• d3wu2l_ first appeared in SCOPe 2.04
  
• d3wu2l_ appears in SCOPe 2.06
  
• d3wu2l_ appears in the current release, SCOPe 2.08