Lineage for d3wu2f_ (3wu2 F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. Protein automated matches [191000] (2 species)
    not a true protein
  7. Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (4 PDB entries)
  8. 1698769Domain d3wu2f_: 3wu2 F: [259621]
    Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2z_
    automated match to d2axtf1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2f_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d3wu2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2f_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d3wu2f_:

Click to download the PDB-style file with coordinates for d3wu2f_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2f_: