Lineage for d1mcta_ (1mct A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796660Species Pig (Sus scrofa) [TaxId:9823] [50517] (34 PDB entries)
    Uniprot P00761 9-231 ! Uniprot P00761
  8. 2796663Domain d1mcta_: 1mct A: [25961]
    Other proteins in same PDB: d1mcti_
    complexed with ca

Details for d1mcta_

PDB Entry: 1mct (more details), 1.6 Å

PDB Description: the refined 1.6 angstroms resolution crystal structure of the complex formed between porcine beta-trypsin and mcti-a, a trypsin inhibitor of squash family
PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1mcta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcta_ b.47.1.2 (A:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]}
ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg
neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg
wgntkssgssypsllqclkapvlsnssckssypgqitgnmicvgflqggkdscqgdsggp
vvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan

SCOPe Domain Coordinates for d1mcta_:

Click to download the PDB-style file with coordinates for d1mcta_.
(The format of our PDB-style files is described here.)

Timeline for d1mcta_: