Lineage for d4w9hl_ (4w9h L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768805Domain d4w9hl_: 4w9h L: [259587]
    Other proteins in same PDB: d4w9ha_, d4w9hb_, d4w9hd_, d4w9he_, d4w9hg_, d4w9hh_, d4w9hj_, d4w9hk1, d4w9hk2
    automated match to d1lqbc_
    complexed with 3jf

Details for d4w9hl_

PDB Entry: 4w9h (more details), 2.1 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-acetamido-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 7)
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9hl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9hl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4w9hl_:

Click to download the PDB-style file with coordinates for d4w9hl_.
(The format of our PDB-style files is described here.)

Timeline for d4w9hl_: