Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries) |
Domain d4w9if_: 4w9i F: [259584] Other proteins in same PDB: d4w9ia_, d4w9ib_, d4w9id_, d4w9ie_, d4w9ig_, d4w9ih_, d4w9ij_, d4w9ik1, d4w9ik2 automated match to d1lqbc_ complexed with 3js |
PDB Entry: 4w9i (more details), 2.4 Å
SCOPe Domain Sequences for d4w9if_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9if_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqer
Timeline for d4w9if_: