Lineage for d4w9ii_ (4w9i I:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041665Protein VHL [49470] (1 species)
  7. 2041666Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries)
  8. 2041730Domain d4w9ii_: 4w9i I: [259583]
    Other proteins in same PDB: d4w9ia_, d4w9ib_, d4w9id_, d4w9ie_, d4w9ig_, d4w9ih_, d4w9ij_, d4w9ik1, d4w9ik2
    automated match to d1lqbc_
    complexed with 3js

Details for d4w9ii_

PDB Entry: 4w9i (more details), 2.4 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((2S,4R)-1-acetyl-4-hydroxypyrrolidine-2-carbonyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 10)
PDB Compounds: (I:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9ii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9ii_ b.3.3.1 (I:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4w9ii_:

Click to download the PDB-style file with coordinates for d4w9ii_.
(The format of our PDB-style files is described here.)

Timeline for d4w9ii_: