Lineage for d4w9jl_ (4w9j L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041663Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2041664Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2041665Protein VHL [49470] (1 species)
  7. 2041666Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries)
  8. 2041700Domain d4w9jl_: 4w9j L: [259564]
    Other proteins in same PDB: d4w9ja_, d4w9jb_, d4w9jd_, d4w9je_, d4w9jg_, d4w9jh_, d4w9jj_, d4w9jk1, d4w9jk2
    automated match to d1lqbc_
    complexed with 3jh

Details for d4w9jl_

PDB Entry: 4w9j (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-((S)-2-acetamido-4-methylpentanamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 13)
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4w9jl_:

Sequence, based on SEQRES records: (download)

>d4w9jl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe

Sequence, based on observed residues (ATOM records): (download)

>d4w9jl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4w9jl_:

Click to download the PDB-style file with coordinates for d4w9jl_.
(The format of our PDB-style files is described here.)

Timeline for d4w9jl_: