SCOPe 2.08: Domain d4tyub1: 4tyu B:2-129

Lineage for d4tyub1 (4tyu B:2-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4tyub1: 4tyu B:2-129 [259548]
   Other proteins in same PDB: d4tyua2, d4tyub2
   automated match to d4kfzd_
   complexed with so4

Details for d4tyub1

PDB Entry: 4tyu, 2.13 Å

PDB Description: homodimeric single domain antibody (sdab) against staphylococcal enterotoxin b (seb)

PDB Compounds: (B:) Single Domain Antibody

SCOPe Domain Sequences for d4tyub1:

Sequence; same for both SEQRES and ATOM records:

>d4tyub1 b.1.1.1 (B:2-129) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtayya
fyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdywgq
gtqvtvss

Timeline for d4tyub1:

• d4tyub1 first appeared in SCOPe 2.04, called d4tyub_
  
• d4tyub1 was called d4tyub_ in SCOPe 2.07