SCOP 1.71: Domain d1d6ra_: 1d6r A:

Lineage for d1d6ra_ (1d6r A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)

8. Domain d1d6ra_: 1d6r A: [25952]
   Other proteins in same PDB: d1d6ri_

Details for d1d6ra_

PDB Entry: 1d6r, 2.3 Å

PDB Description: crystal structure of cancer chemopreventive bowman-birk inhibitor in ternary complex with bovine trypsin at 2.3 a resolution. structural basis of janus-faced serine protease inhibitor specificity

SCOP Domain Sequences for d1d6ra_:

Sequence; same for both SEQRES and ATOM records:

>d1d6ra_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1d6ra_:

• d1d6ra_ first appeared (with stable ids) in SCOP 1.55
  
• d1d6ra_ appears in SCOP 1.69
  
• d1d6ra_ appears in SCOP 1.73
  
• d1d6ra_ appears in the current release, SCOPe 2.08