SCOPe 2.04: Domain d4quoa4: 4quo A:540-867

Lineage for d4quoa4 (4quo A:540-867)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (10 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [259505] (1 PDB entry)

8. Domain d4quoa4: 4quo A:540-867 [259506]
   Other proteins in same PDB: d4quoa1, d4quoa2, d4quoa3
   automated match to d2gtqa4
   complexed with 3dz, gol, imd, so4, zn

Details for d4quoa4

PDB Entry: 4quo, 1.65 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-hphep[ch2]phe(3-ch2nh2)

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4quoa4:

Sequence; same for both SEQRES and ATOM records:

>d4quoa4 a.118.1.0 (A:540-867) automated matches {Neisseria meningitidis [TaxId: 122586]}
pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis
ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa
kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn
gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk
arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn
lvkqalqriraqeglskdvgeivgkild

Timeline for d4quoa4:

• d4quoa4 is new in SCOPe 2.04-stable
  
• d4quoa4 appears in SCOPe 2.05
  
• d4quoa4 appears in the current release, SCOPe 2.08