SCOPe 2.05: Domain d4qx3a3: 4qx3 A:500-644

Lineage for d4qx3a3 (4qx3 A:500-644)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (31 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1444] [258998] (4 PDB entries)

8. Domain d4qx3a3: 4qx3 A:500-644 [259502]
   Other proteins in same PDB: d4qx3a1, d4qx3a2
   automated match to d1dlca1

Details for d4qx3a3

PDB Entry: 4qx3, 2.9 Å

PDB Description: cry3a toxin structure obtained by injecting bacillus thuringiensis cells in an xfel beam, collecting data by serial femtosecond crystallographic methods and processing data with the crystfel software suite

PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx3a3:

Sequence; same for both SEQRES and ATOM records:

>d4qx3a3 b.18.1.0 (A:500-644) automated matches {Bacillus thuringiensis [TaxId: 1444]}
ffnmidskkitqlplvkayklqsgasvvagprftggdiiqctengsaatiyvtpdvsysq
kyrarihyastsqitftlsldgapfnqyyfdktinkgdtltynsfnlasfstpfelsgnn
lqigvtglsagdkvyidkiefipvn

Timeline for d4qx3a3:

• d4qx3a3 first appeared in SCOPe 2.04
  
• d4qx3a3 appears in SCOPe 2.06
  
• d4qx3a3 appears in the current release, SCOPe 2.08