Lineage for d4qx3a2 (4qx3 A:290-499)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557282Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1557289Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 1557300Family b.77.2.0: automated matches [254290] (1 protein)
    not a true family
  6. 1557301Protein automated matches [254673] (3 species)
    not a true protein
  7. 1557306Species Bacillus thuringiensis [TaxId:1444] [258996] (3 PDB entries)
  8. 1557309Domain d4qx3a2: 4qx3 A:290-499 [259497]
    Other proteins in same PDB: d4qx3a1, d4qx3a3
    automated match to d1dlca2

Details for d4qx3a2

PDB Entry: 4qx3 (more details), 2.9 Å

PDB Description: cry3a toxin structure obtained by injecting bacillus thuringiensis cells in an xfel beam, collecting data by serial femtosecond crystallographic methods and processing data with the crystfel software suite
PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qx3a2 b.77.2.0 (A:290-499) automated matches {Bacillus thuringiensis [TaxId: 1444]}
lypkevkteltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpg
yygndsfnywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnla
vwpsavysgvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgy
shqlnyvmcflmqgsrgtipvltwthksvd

SCOPe Domain Coordinates for d4qx3a2:

Click to download the PDB-style file with coordinates for d4qx3a2.
(The format of our PDB-style files is described here.)

Timeline for d4qx3a2: