Class a: All alpha proteins [46456] (285 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.2: DNA-binding domain (fragment?) of the TraM protein [63566] (2 proteins) old provisional classification awaiting the entire protein structure; structure of a different fragment of this protein (PDB 2g7o) is classified into a different superfamily automatically mapped to Pfam PF05261 |
Protein automated matches [259492] (1 species) not a true protein |
Species Escherichia coli [TaxId:83333] [259493] (1 PDB entry) |
Domain d4qpoa_: 4qpo A: [259495] automated match to d1dp3a_ complexed with po4 |
PDB Entry: 4qpo (more details), 2 Å
SCOPe Domain Sequences for d4qpoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qpoa_ a.55.1.2 (A:) automated matches {Escherichia coli [TaxId: 83333]} akvnlyisndayekinaiiekrrqegarekdvsfsatasmllelglrvheaqm
Timeline for d4qpoa_: