Lineage for d4qeha_ (4qeh A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575074Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1575125Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1575126Protein D-xylose isomerase [51666] (13 species)
  7. 1575254Species Streptomyces rubiginosus [TaxId:1929] [51670] (40 PDB entries)
  8. 1575278Domain d4qeha_: 4qeh A: [259490]
    automated match to d1mnza_
    complexed with 32o, mg

Details for d4qeha_

PDB Entry: 4qeh (more details), 1.55 Å

PDB Description: room temperature x-ray structure of d-xylose isomerase in complex with two mg2+ ions and l-ribose
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4qeha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qeha_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d4qeha_:

Click to download the PDB-style file with coordinates for d4qeha_.
(The format of our PDB-style files is described here.)

Timeline for d4qeha_: