Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein automated matches [190399] (10 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259476] (2 PDB entries) |
Domain d4q76b_: 4q76 B: [259479] automated match to d1t3ia_ mutant |
PDB Entry: 4q76 (more details), 1.9 Å
SCOPe Domain Sequences for d4q76b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q76b_ c.67.1.3 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vslghrvrkdfrilhqevngsklvyldsaatsqkpaavldalqnyyefynsnvhrgihyl sakatdefelarkkvarfinasdsreivftrnateainlvayswglsnlkpgdeviltva ehhscivpwqivsqktgavlkfvtlnedevpdinklrelispktklvavhhvsnvlassl pieeivvwahdvgakvlvdacqsvphmvvdvqklnadflvasshkmcgptgigflygksd llhsmppflgggemisdvfldhstyaeppsrfeagtpaigeaialgaavdylsgigmpki heyeveigkylyeklsslpdvriygprpsesvhrgalcsfnveglhptdlatfldqqhgv airsghhsaqplhrylgvnasaraslyfyntkddvdafivaladtvsffnsfk
Timeline for d4q76b_: