SCOPe 2.04: Domain d4q75a_: 4q75 A:

Lineage for d4q75a_ (4q75 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein automated matches [190399] (9 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [259476] (2 PDB entries)

8. Domain d4q75a_: 4q75 A: [259477]
   automated match to d1t3ia_

Details for d4q75a_

PDB Entry: 4q75, 1.71 Å

PDB Description: Crystal structure of Nfs2, the plastidial cysteine desulfurase from Arabidopsis thaliana

PDB Compounds: (A:) Cysteine desulfurase 2, chloroplastic

SCOPe Domain Sequences for d4q75a_:

Sequence; same for both SEQRES and ATOM records:

>d4q75a_ c.67.1.3 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
vslghrvrkdfrilhqevngsklvyldsaatsqkpaavldalqnyyefynsnvhrgihyl
sakatdefelarkkvarfinasdsreivftrnateainlvayswglsnlkpgdeviltva
ehhscivpwqivsqktgavlkfvtlnedevpdinklrelispktklvavhhvsnvlassl
pieeivvwahdvgakvlvdacqsvphmvvdvqklnadflvasshkmcgptgigflygksd
llhsmppflgggemisdvfldhstyaeppsrfeagtpaigeaialgaavdylsgigmpki
heyeveigkylyeklsslpdvriygprpsesvhrgalcsfnveglhptdlatfldqqhgv
airsghhcaqplhrylgvnasaraslyfyntkddvdafivaladtvsffnsfk

Timeline for d4q75a_:

• d4q75a_ is new in SCOPe 2.04-stable
  
• d4q75a_ appears in SCOPe 2.05
  
• d4q75a_ appears in the current release, SCOPe 2.08