Lineage for d4otxl2 (4otx L:111-212)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030823Domain d4otxl2: 4otx L:111-212 [259446]
    Other proteins in same PDB: d4otxl1, d4otxm1
    automated match to d3oz9l2
    complexed with azi, cl

Details for d4otxl2

PDB Entry: 4otx (more details), 2.1 Å

PDB Description: structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment
PDB Compounds: (L:) N203 light chain

SCOPe Domain Sequences for d4otxl2:

Sequence, based on SEQRES records: (download)

>d4otxl2 b.1.1.2 (L:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrn

Sequence, based on observed residues (ATOM records): (download)

>d4otxl2 b.1.1.2 (L:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceapivksfnrn

SCOPe Domain Coordinates for d4otxl2:

Click to download the PDB-style file with coordinates for d4otxl2.
(The format of our PDB-style files is described here.)

Timeline for d4otxl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4otxl1