SCOPe 2.04: Domain d4p2ab_: 4p2a B:

Lineage for d4p2ab_ (4p2a B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d4p2ab_: 4p2a B: [259440]
   automated match to d3qdoa_
   complexed with hg

Details for d4p2ab_

PDB Entry: 4p2a, 2.7 Å

PDB Description: Structure of mouse VPS26A bound to rat SNX27 PDZ domain

PDB Compounds: (B:) Sorting nexin-27

SCOPe Domain Sequences for d4p2ab_:

Sequence; same for both SEQRES and ATOM records:

>d4p2ab_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsprvvrivksesgygfnvrgqvseggqlrsingelyaplqhvsavlpggaadragvrkg
drilevngvnvegathkqvvdliragekeliltvlsv

Timeline for d4p2ab_:

• d4p2ab_ is new in SCOPe 2.04-stable
  
• d4p2ab_ appears in SCOPe 2.05
  
• d4p2ab_ appears in the current release, SCOPe 2.08, called d4p2ab1