Lineage for d4oq9o_ (4oq9 O:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1563153Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1564407Superfamily b.121.7: Satellite viruses [88650] (1 family) (S)
  5. 1564408Family b.121.7.1: Satellite viruses [88651] (3 proteins)
  6. 1564416Protein STNV coat protein [49621] (1 species)
  7. 1564417Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (8 PDB entries)
  8. 1564485Domain d4oq9o_: 4oq9 O: [259434]
    automated match to d1a34a_
    protein/RNA complex; complexed with mg, na, po4, so4

Details for d4oq9o_

PDB Entry: 4oq9 (more details), 1.45 Å

PDB Description: Satellite Tobacco Mosaic Virus Refined to 1.4 A Resolution using non-crystallographic symmetry restraints
PDB Compounds: (O:) coat protein

SCOPe Domain Sequences for d4oq9o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oq9o_ b.121.7.1 (O:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]}
nsnvvtmiragsypkvnptptwvraipfevsvqsgiafkvpvgslfsanfrtdsftsvtv
msvrawtqltppvneysfvrlkplfktgdsteefegrasnintrasvgyriptnlrqntv
aadnvcevrsncrqvalvisccfn

SCOPe Domain Coordinates for d4oq9o_:

Click to download the PDB-style file with coordinates for d4oq9o_.
(The format of our PDB-style files is described here.)

Timeline for d4oq9o_: