SCOPe 2.07: Domain d4ogya_: 4ogy A:

Lineage for d4ogya_ (4ogy A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)

8. Domain d4ogya_: 4ogy A: [259412]
   Other proteins in same PDB: d4ogyl1, d4ogyl2, d4ogyn1, d4ogyn2
   automated match to d2anya_
   complexed with edo

Details for d4ogya_

PDB Entry: 4ogy, 2.1 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom resolution

PDB Compounds: (A:) Plasma kallikrein

SCOPe Domain Sequences for d4ogya_:

Sequence; same for both SEQRES and ATOM records:

>d4ogya_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqssd

Timeline for d4ogya_:

• d4ogya_ first appeared in SCOPe 2.04
  
• d4ogya_ appears in SCOPe 2.06
  
• d4ogya_ appears in the current release, SCOPe 2.08