Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (8 species) not a true protein |
Species Listeria monocytogenes [TaxId:1639] [259405] (2 PDB entries) |
Domain d4nl3a_: 4nl3 A: [259406] automated match to d4j6wf_ protein/RNA complex |
PDB Entry: 4nl3 (more details), 3.1 Å
SCOPe Domain Sequences for d4nl3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nl3a_ b.38.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]} kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai stfspqknvaln
Timeline for d4nl3a_: