SCOPe 2.04: Domain d4nl3a_: 4nl3 A:

Lineage for d4nl3a_ (4nl3 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (8 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [259405] (2 PDB entries)

8. Domain d4nl3a_: 4nl3 A: [259406]
   automated match to d4j6wf_
   protein/RNA complex

Details for d4nl3a_

PDB Entry: 4nl3, 3.1 Å

PDB Description: crystal structure of listeria monocytogenes hfq in complex with u6 rna

PDB Compounds: (A:) Protein hfq

SCOPe Domain Sequences for d4nl3a_:

Sequence; same for both SEQRES and ATOM records:

>d4nl3a_ b.38.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}
kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai
stfspqknvaln

Timeline for d4nl3a_:

• d4nl3a_ is new in SCOPe 2.04-stable
  
• d4nl3a_ appears in SCOPe 2.05
  
• d4nl3a_ appears in the current release, SCOPe 2.08