SCOPe 2.06: Domain d4n0ka1: 4n0k A:-5-101

Lineage for d4n0ka1 (4n0k A:-5-101)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries)
   Uniprot P00044

8. Domain d4n0ka1: 4n0k A:-5-101 [259387]
   Other proteins in same PDB: d4n0ka2, d4n0kb2
   automated match to d3tyia_
   complexed with hem, t3y

Details for d4n0ka1

PDB Entry: 4n0k, 1.05 Å

PDB Description: atomic resolution crystal structure of a cytochrome c-calixarene complex

PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d4n0ka1:

Sequence; same for both SEQRES and ATOM records:

>d4n0ka1 a.3.1.1 (A:-5-101) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfkteclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkka

Timeline for d4n0ka1:

• d4n0ka1 first appeared in SCOPe 2.04, called d4n0ka_
  
• d4n0ka1 was called d4n0ka_ in SCOPe 2.05
  
• d4n0ka1 appears in SCOPe 2.07
  
• d4n0ka1 appears in the current release, SCOPe 2.08