SCOPe 2.04: Domain d2moea_: 2moe A:

Lineage for d2moea_ (2moe A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.10: DNA-binding domain [54170] (1 superfamily)
   beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.10.1: DNA-binding domain [54171] (5 families)

5. Family d.10.1.0: automated matches [254255] (1 protein)
   not a true family

6. Protein automated matches [254589] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255497] (2 PDB entries)

8. Domain d2moea_: 2moe A: [259379]
   automated match to d2ky8a_
   protein/DNA complex

Details for d2moea_

PDB Entry: 2moe

PDB Description: Solution structure of MBD4 methyl-cytosine binding domain bound to methylated DNA

PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d2moea_:

Sequence; same for both SEQRES and ATOM records:

>d2moea_ d.10.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstecrksvpcgwervvkqrlfgktagrfdvyfispqglkfrsksslanylhkngetslk
pedfdftvlsk

Timeline for d2moea_:

• d2moea_ is new in SCOPe 2.04-stable
  
• d2moea_ appears in SCOPe 2.05
  
• d2moea_ appears in the current release, SCOPe 2.08, called d2moea1