Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Entamoeba histolytica [TaxId:885315] [259372] (1 PDB entry) |
Domain d4mita_: 4mit A: [259373] automated match to d1s8fb_ complexed with gtp, mg |
PDB Entry: 4mit (more details), 2.35 Å
SCOPe Domain Sequences for d4mita_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mita_ c.37.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 885315]} ptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdtag leeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkldtr ndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlm
Timeline for d4mita_: