SCOPe 2.05: Domain d4d02a1: 4d02 A:2-249

Lineage for d4d02a1 (4d02 A:2-249)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259349] (2 PDB entries)

8. Domain d4d02a1: 4d02 A:2-249 [259350]
   Other proteins in same PDB: d4d02a2
   automated match to d1ycga2
   complexed with cl, fe, fmn, gol, o, po4

Details for d4d02a1

PDB Entry: 4d02, 1.76 Å

PDB Description: the crystallographic structure of flavorubredoxin from escherichia coli

PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d4d02a1:

Sequence; same for both SEQRES and ATOM records:

>d4d02a1 d.157.1.0 (A:2-249) automated matches {Escherichia coli [TaxId: 83333]}
sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
ylkwaady

Timeline for d4d02a1:

• d4d02a1 first appeared in SCOPe 2.04
  
• d4d02a1 appears in SCOPe 2.06
  
• d4d02a1 appears in the current release, SCOPe 2.08