Lineage for d3btme_ (3btm E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 112135Protein Trypsin(ogen) [50515] (7 species)
  7. 112136Species Cow (Bos taurus) [TaxId:9913] [50516] (147 PDB entries)
  8. 112222Domain d3btme_: 3btm E: [25935]
    Other proteins in same PDB: d3btmi_

Details for d3btme_

PDB Entry: 3btm (more details), 1.8 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

SCOP Domain Sequences for d3btme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btme_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d3btme_:

Click to download the PDB-style file with coordinates for d3btme_.
(The format of our PDB-style files is described here.)

Timeline for d3btme_: