Lineage for d4cpkb1 (4cpk B:27-138)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896937Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1896938Protein automated matches [190205] (21 species)
    not a true protein
  7. 1897009Species Staphylococcus aureus [TaxId:158878] [256155] (4 PDB entries)
  8. 1897015Domain d4cpkb1: 4cpk B:27-138 [259337]
    Other proteins in same PDB: d4cpka2, d4cpka3, d4cpkb2, d4cpkb3
    automated match to d1vqqa1
    complexed with cd, cl, mur; mutant

Details for d4cpkb1

PDB Entry: 4cpk (more details), 2.35 Å

PDB Description: crystal structure of pbp2a double clinical mutant n146k-e150k from mrsa
PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4cpkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpkb1 d.17.4.0 (B:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d4cpkb1:

Click to download the PDB-style file with coordinates for d4cpkb1.
(The format of our PDB-style files is described here.)

Timeline for d4cpkb1: