SCOPe 2.08: Domain d4cqmb1: 4cqm B:1-237

Lineage for d4cqmb1 (4cqm B:1-237)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d4cqmb1: 4cqm B:1-237 [259336]
   Other proteins in same PDB: d4cqmb2, d4cqmf2, d4cqmj2, d4cqmn2
   automated match to d1h5qa_
   complexed with act, edo, gol, nap

Details for d4cqmb1

PDB Entry: 4cqm, 2.34 Å

PDB Description: Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP

PDB Compounds: (B:) carbonyl reductase family member 4

SCOPe Domain Sequences for d4cqmb1:

Sequence, based on SEQRES records:

>d4cqmb1 c.2.1.0 (B:1-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
vhtdmtkdlkeehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

Sequence, based on observed residues (ATOM records):

>d4cqmb1 c.2.1.0 (B:1-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdkvcavfggsrgigravaqlmarkgyrlaviarnlegakaaagdlggdhlafscdvake
hdvqntfeelekhlgrvnflvnaaginrdgllvrtktedmvsqlhtnllgsmltckaamr
tmiqqqggsivnvgsivglkgnsgqsvysaskgglvgfsralakevarkkirvnvvapgf
vhehlkkniplgrfgetievahavvfllespyitghvlvvdgglqlil

Timeline for d4cqmb1:

• d4cqmb1 first appeared in SCOPe 2.04, called d4cqmb_
  
• d4cqmb1 appears in SCOPe 2.07