Lineage for d4ch0s1 (4ch0 S:28-121)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein automated matches [190332] (5 species)
not a true protein
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258944] (3 PDB entries) 
Domain d4ch0s1: 4ch0 S:28-121 [259332]
Other proteins in same PDB: d4ch0s2
automated match to d2cqda1
Details for d4ch0s1
PDB Entry: 4ch0 (more details)
PDB Description: rrm domain from c. elegans sup-12
PDB Compounds: (S:) protein sup-12, isoform bSCOPe Domain Sequences for d4ch0s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ch0s1 d.58.7.1 (S:28-121) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgygfvtmkdra
saerackdpnpiidgrkanvnlaylgakprtnvq
SCOPe Domain Coordinates for d4ch0s1:
Click to download the PDB-style file with coordinates for d4ch0s1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ch0s1:
- d4ch0s1 first appeared in SCOPe 2.04, called d4ch0s_
- d4ch0s1 appears in SCOPe 2.07
View in 3D
