Lineage for d4bl3b2 (4bl3 B:139-327)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1942756Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 1942757Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 1942785Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 1942786Protein automated matches [226981] (9 species)
    not a true protein
  7. 1942826Species Staphylococcus aureus [TaxId:1280] [256159] (3 PDB entries)
  8. 1942832Domain d4bl3b2: 4bl3 B:139-327 [259320]
    Other proteins in same PDB: d4bl3a1, d4bl3a3, d4bl3b1, d4bl3b3
    automated match to d1vqqa2
    complexed with cd, cl, mur; mutant

Details for d4bl3b2

PDB Entry: 4bl3 (more details), 3 Å

PDB Description: crystal structure of pbp2a clinical mutant n146k from mrsa
PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d4bl3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bl3b2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 1280]}
dqsihieklksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d4bl3b2:

Click to download the PDB-style file with coordinates for d4bl3b2.
(The format of our PDB-style files is described here.)

Timeline for d4bl3b2: