| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein automated matches [190184] (3 species) not a true protein |
| Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries) |
| Domain d4uujc1: 4uuj C:22-124 [259308] Other proteins in same PDB: d4uuja1, d4uuja2, d4uuja3, d4uujb1, d4uujb2, d4uujc2 automated match to d1r3jc_ complexed with co, dga, f09, ind, k, po4, xa7 |
PDB Entry: 4uuj (more details), 2.4 Å
SCOPe Domain Sequences for d4uujc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uujc1 f.14.1.1 (C:22-124) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d4uujc1: