SCOPe 2.07: Domain d4uujc1: 4uuj C:22-124

Lineage for d4uujc1 (4uuj C:22-124)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d4uujc1: 4uuj C:22-124 [259308]
   Other proteins in same PDB: d4uuja1, d4uuja2, d4uuja3, d4uujb1, d4uujb2, d4uujc2
   automated match to d1r3jc_
   complexed with co, dga, f09, ind, k, po4, xa7

Details for d4uujc1

PDB Entry: 4uuj, 2.4 Å

PDB Description: potassium channel kcsa-fab with tetrahexylammonium

PDB Compounds: (C:) voltage-gated potassium channel kcsa

SCOPe Domain Sequences for d4uujc1:

Sequence; same for both SEQRES and ATOM records:

>d4uujc1 f.14.1.1 (C:22-124) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d4uujc1:

• d4uujc1 first appeared in SCOPe 2.04, called d4uujc_
  
• d4uujc1 appears in SCOPe 2.06
  
• d4uujc1 appears in the current release, SCOPe 2.08