Lineage for d4uujc1 (4uuj C:22-124)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023715Protein automated matches [190184] (3 species)
    not a true protein
  7. 3023725Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)
  8. 3023730Domain d4uujc1: 4uuj C:22-124 [259308]
    Other proteins in same PDB: d4uuja1, d4uuja2, d4uuja3, d4uujb1, d4uujb2, d4uujc2
    automated match to d1r3jc_
    complexed with co, dga, f09, ind, k, po4, xa7

Details for d4uujc1

PDB Entry: 4uuj (more details), 2.4 Å

PDB Description: potassium channel kcsa-fab with tetrahexylammonium
PDB Compounds: (C:) voltage-gated potassium channel kcsa

SCOPe Domain Sequences for d4uujc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uujc1 f.14.1.1 (C:22-124) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d4uujc1:

Click to download the PDB-style file with coordinates for d4uujc1.
(The format of our PDB-style files is described here.)

Timeline for d4uujc1: