Lineage for d4un2b_ (4un2 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1723911Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1723935Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1723936Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1724030Protein automated matches [190533] (3 species)
    not a true protein
  7. 1724031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)
  8. 1724032Domain d4un2b_: 4un2 B: [259302]
    Other proteins in same PDB: d4un2a_
    automated match to d1wr1b1

Details for d4un2b_

PDB Entry: 4un2 (more details), 1.51 Å

PDB Description: Crystal structure of the UBA domain of Dsk2 in complex with Ubiquitin
PDB Compounds: (B:) Ubiquitin domain-containing protein DSK2

SCOPe Domain Sequences for d4un2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4un2b_ a.5.2.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
speeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsll

SCOPe Domain Coordinates for d4un2b_:

Click to download the PDB-style file with coordinates for d4un2b_.
(The format of our PDB-style files is described here.)

Timeline for d4un2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4un2a_