Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.102: Regulatory factor Nef [55670] (1 superfamily) alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) |
Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins) automatically mapped to Pfam PF00469 |
Protein automated matches [191288] (2 species) not a true protein |
Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries) |
Domain d4u5wc_: 4u5w C: [259301] Other proteins in same PDB: d4u5wb1, d4u5wd1, d4u5wd2 automated match to d3reac_ complexed with iod, mpd |
PDB Entry: 4u5w (more details), 1.86 Å
SCOPe Domain Sequences for d4u5wc_:
Sequence, based on SEQRES records: (download)
>d4u5wc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn ytpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwrfd sklafhhmarelhpeyyk
>d4u5wc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn ytpgpgirypltfgwcfklvpvepkevlvwrfdsklafhhmarelhpeyyk
Timeline for d4u5wc_:
View in 3D Domains from other chains: (mouse over for more information) d4u5wa_, d4u5wb1, d4u5wd1, d4u5wd2 |