SCOPe 2.05: Domain d4u5wc_: 4u5w C:

Lineage for d4u5wc_ (4u5w C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families)

5. Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
   automatically mapped to Pfam PF00469

6. Protein automated matches [191288] (2 species)
   not a true protein

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries)

8. Domain d4u5wc_: 4u5w C: [259301]
   Other proteins in same PDB: d4u5wb1, d4u5wd1, d4u5wd2
   automated match to d3reac_
   complexed with iod, mpd

Details for d4u5wc_

PDB Entry: 4u5w, 1.86 Å

PDB Description: crystal structure of hiv-1 nef-sf2 core domain in complex with the src family kinase hck sh3-sh2 tandem regulatory domains

PDB Compounds: (C:) Protein Nef

SCOPe Domain Sequences for d4u5wc_:

Sequence, based on SEQRES records:

>d4u5wc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn
ytpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwrfd
sklafhhmarelhpeyyk

Sequence, based on observed residues (ATOM records):

>d4u5wc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
gfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqn
ytpgpgirypltfgwcfklvpvepkevlvwrfdsklafhhmarelhpeyyk

Timeline for d4u5wc_:

• d4u5wc_ first appeared in SCOPe 2.04
  
• d4u5wc_ appears in SCOPe 2.06
  
• d4u5wc_ appears in the current release, SCOPe 2.08