Class a: All alpha proteins [46456] (290 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
Domain d4tv8e_: 4tv8 E: [259296] Other proteins in same PDB: d4tv8a1, d4tv8a2, d4tv8b1, d4tv8b2, d4tv8c1, d4tv8c2, d4tv8d1, d4tv8d2, d4tv8f1, d4tv8f2, d4tv8f3 automated match to d3ryce_ complexed with 3gt, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4tv8 (more details), 2.1 Å
SCOPe Domain Sequences for d4tv8e_:
Sequence, based on SEQRES records: (download)
>d4tv8e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d4tv8e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d4tv8e_: