SCOPe 2.04: Domain d4qyib_: 4qyi B:

Lineage for d4qyib_ (4qyi B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (23 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [259286] (2 PDB entries)

8. Domain d4qyib_: 4qyi B: [259288]
   automated match to d1r3ub_
   complexed with epe, gol, mg, po4

Details for d4qyib_

PDB Entry: 4qyi, 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' with hepes molecule in the active site

PDB Compounds: (B:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4qyib_:

Sequence; same for both SEQRES and ATOM records:

>d4qyib_ c.61.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
ieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvtid
fisassygnqtettgkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkal
kfctlldkperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvv

Timeline for d4qyib_:

• d4qyib_ is new in SCOPe 2.04-stable
  
• d4qyib_ appears in SCOPe 2.05
  
• d4qyib_ appears in the current release, SCOPe 2.08