Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) automatically mapped to Pfam PF03454 |
Family b.85.6.0: automated matches [259258] (1 protein) not a true family |
Protein automated matches [259259] (1 species) not a true protein |
Species Rattus norvegicus [TaxId:10116] [259260] (1 PDB entry) |
Domain d4pd0a3: 4pd0 A:654-736 [259261] Other proteins in same PDB: d4pd0a1, d4pd0a2 automated match to d1t3ea1 |
PDB Entry: 4pd0 (more details), 1.7 Å
SCOPe Domain Sequences for d4pd0a3:
Sequence, based on SEQRES records: (download)
>d4pd0a3 b.85.6.0 (A:654-736) automated matches {Rattus norvegicus [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
>d4pd0a3 b.85.6.0 (A:654-736) automated matches {Rattus norvegicus [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqsrlmsmrsangllmlppk teqyvelhkgevvdvmvigrl
Timeline for d4pd0a3: