Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins) automatically mapped to Pfam PF01026 |
Protein automated matches [259240] (1 species) not a true protein |
Species Escherichia coli [TaxId:83333] [259241] (1 PDB entry) |
Domain d4p5ua1: 4p5u A:1-260 [259242] Other proteins in same PDB: d4p5ua2 automated match to d1xwya1 |
PDB Entry: 4p5u (more details), 2 Å
SCOPe Domain Sequences for d4p5ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p5ua1 c.1.9.12 (A:1-260) automated matches {Escherichia coli [TaxId: 83333]} mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged aawlaattdanvktlfgiaf
Timeline for d4p5ua1: