SCOPe 2.08: Domain d4p5ua1: 4p5u A:1-260

Lineage for d4p5ua1 (4p5u A:1-260)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.12: TatD Mg-dependent DNase-like [82267] (5 proteins)
   automatically mapped to Pfam PF01026

6. Protein automated matches [259240] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259241] (1 PDB entry)

8. Domain d4p5ua1: 4p5u A:1-260 [259242]
   Other proteins in same PDB: d4p5ua2
   automated match to d1xwya1

Details for d4p5ua1

PDB Entry: 4p5u, 2 Å

PDB Description: crystal structure of tatd

PDB Compounds: (A:) Tat-linked quality control protein TatD

SCOPe Domain Sequences for d4p5ua1:

Sequence; same for both SEQRES and ATOM records:

>d4p5ua1 c.1.9.12 (A:1-260) automated matches {Escherichia coli [TaxId: 83333]}
mfdigvnltssqfakdrddvvacafdagvngllitgtnlresqqaqklarqysscwstag
vhphdssqwqaateeaiielaaqpevvaigecgldfnrnfstpeeqerafvaqlriaadl
nmpvfmhcrdaherfmtllepwldklpgavlhcftgtreemqacvahgiyigitgwvcde
rrglelrellplipaekllietdapyllprdltpkpssrrnepahlphilqriahwrged
aawlaattdanvktlfgiaf

Timeline for d4p5ua1:

• d4p5ua1 first appeared in SCOPe 2.04, called d4p5ua_
  
• d4p5ua1 appears in SCOPe 2.07