Lineage for d4ox7a_ (4ox7 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1655310Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 1655311Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 1655345Protein automated matches [191074] (6 species)
    not a true protein
  7. 1655348Species Synechococcus elongatus [TaxId:1140] [259235] (2 PDB entries)
  8. 1655350Domain d4ox7a_: 4ox7 A: [259237]
    automated match to d3ssqa_

Details for d4ox7a_

PDB Entry: 4ox7 (more details), 2.1 Å

PDB Description: structure of synechococcus elongatus pcc 7942 ccmk2
PDB Compounds: (A:) Carbon dioxide-concentrating mechanism protein CcmK

SCOPe Domain Sequences for d4ox7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ox7a_ d.58.56.1 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]}
piavgmietlgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvsagl
dsakrvaggevlshhiiarphenleyvlpiryteaveqfrm

SCOPe Domain Coordinates for d4ox7a_:

Click to download the PDB-style file with coordinates for d4ox7a_.
(The format of our PDB-style files is described here.)

Timeline for d4ox7a_: