Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
Protein automated matches [191074] (6 species) not a true protein |
Species Synechococcus elongatus [TaxId:1140] [259235] (2 PDB entries) |
Domain d4ox7a_: 4ox7 A: [259237] automated match to d3ssqa_ |
PDB Entry: 4ox7 (more details), 2.1 Å
SCOPe Domain Sequences for d4ox7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ox7a_ d.58.56.1 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]} piavgmietlgfpavveaadamvkaarvtlvgyekigsgrvtvivrgdvsevqasvsagl dsakrvaggevlshhiiarphenleyvlpiryteaveqfrm
Timeline for d4ox7a_: