SCOPe 2.04: Domain d4c1ga_: 4c1g A:

Lineage for d4c1ga_ (4c1g A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (12 species)

7. Species Serratia marcescens [TaxId:615] [190018] (5 PDB entries)

8. Domain d4c1ga_: 4c1g A: [259172]
   automated match to d1jjta_
   complexed with mco, so4, zn

Details for d4c1ga_

PDB Entry: 4c1g, 1.71 Å

PDB Description: crystal structure of the metallo-beta-lactamase imp-1 with d-captopril

PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d4c1ga_:

Sequence; same for both SEQRES and ATOM records:

>d4c1ga_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnesk

Timeline for d4c1ga_:

• d4c1ga_ is new in SCOPe 2.04-stable
  
• d4c1ga_ appears in SCOPe 2.05
  
• d4c1ga_ appears in the current release, SCOPe 2.08