Class b: All beta proteins [48724] (176 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (14 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259164] (1 PDB entry) |
Domain d4c0sa3: 4c0s A:337-455 [259167] Other proteins in same PDB: d4c0sa1, d4c0sa2, d4c0sb1, d4c0sb2 automated match to d1f60a2 complexed with gdp, mg |
PDB Entry: 4c0s (more details), 2.7 Å
SCOPe Domain Sequences for d4c0sa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c0sa3 b.44.1.0 (A:337-455) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aaqftsqviilnhpgqisagyspvidchtahiackfaelkekidrrsgkklednpkslks gdaaivemvpgkpmcvesfsqypplgrfavrdmrqtvavgviknvekksggagkvtksa
Timeline for d4c0sa3: