SCOPe 2.06: Domain d4c0sb3: 4c0s B:337-445

Lineage for d4c0sb3 (4c0s B:337-445)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (16 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259164] (1 PDB entry)

8. Domain d4c0sb3: 4c0s B:337-445 [259166]
   Other proteins in same PDB: d4c0sa1, d4c0sa2, d4c0sb1, d4c0sb2
   automated match to d1f60a2
   complexed with gdp, mg

Details for d4c0sb3

PDB Entry: 4c0s, 2.7 Å

PDB Description: mammalian translation elongation factor eef1a2

PDB Compounds: (B:) Elongation factor 1-alpha 2

SCOPe Domain Sequences for d4c0sb3:

Sequence; same for both SEQRES and ATOM records:

>d4c0sb3 b.44.1.0 (B:337-445) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aaqftsqviilnhpgqisagyspvidchtahiackfaelkekidrrsgkklednpkslks
gdaaivemvpgkpmcvesfsqypplgrfavrdmrqtvavgviknvekks

Timeline for d4c0sb3:

• d4c0sb3 first appeared in SCOPe 2.04
  
• d4c0sb3 appears in SCOPe 2.05
  
• d4c0sb3 appears in SCOPe 2.07
  
• d4c0sb3 appears in the current release, SCOPe 2.08