Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [259156] (2 PDB entries) |
Domain d4c0sa1: 4c0s A:4-242 [259158] Other proteins in same PDB: d4c0sa2, d4c0sa3, d4c0sb2, d4c0sb3 automated match to d1f60a3 complexed with gdp, mg |
PDB Entry: 4c0s (more details), 2.7 Å
SCOPe Domain Sequences for d4c0sa1:
Sequence, based on SEQRES records: (download)
>d4c0sa1 c.37.1.0 (A:4-242) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemgkgsfkyawvldkl kaerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagvgef eagiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikkigy npatvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptrpt
>d4c0sa1 c.37.1.0 (A:4-242) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ekthinivvighvdsgkstttghliykcggidkrtiekfekeaaemkgsfkyawvldklk aerergitidislwkfettkyyitiidapghrdfiknmitgtsqadcavlivaagvgefe agiskngqtrehallaytlgvkqlivgvnkmdstepaysekrydeivkevsayikkigyn patvpfvpisgwhgdnmlepspnmpwfkgwkverkegnasgvsllealdtilpptrpt
Timeline for d4c0sa1: