SCOPe 2.07: Domain d3wu1b_: 3wu1 B:

Lineage for d3wu1b_ (3wu1 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)

8. Domain d3wu1b_: 3wu1 B: [259151]
   Other proteins in same PDB: d3wu1a_
   automated match to d1k79a_
   protein/DNA complex

Details for d3wu1b_

PDB Entry: 3wu1, 2.4 Å

PDB Description: crystal structure of the ets1-runx1-dna ternary complex

PDB Compounds: (B:) Protein C-ets-1

SCOPe Domain Sequences for d3wu1b_:

Sequence; same for both SEQRES and ATOM records:

>d3wu1b_ a.4.5.21 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkrknkpkmnyeklsrg
lryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvkp

Timeline for d3wu1b_:

• d3wu1b_ first appeared in SCOPe 2.04
  
• d3wu1b_ appears in SCOPe 2.06
  
• d3wu1b_ appears in the current release, SCOPe 2.08