SCOPe 2.04: Domain d3wtvc_: 3wtv C:

Lineage for d3wtvc_ (3wtv C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (8 PDB entries)

8. Domain d3wtvc_: 3wtv C: [259145]
   Other proteins in same PDB: d3wtva_, d3wtvb_, d3wtvf_
   automated match to d1gvjb_
   protein/DNA complex

Details for d3wtvc_

PDB Entry: 3wtv, 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna

PDB Compounds: (C:) Protein C-ets-1

SCOPe Domain Sequences for d3wtvc_:

Sequence; same for both SEQRES and ATOM records:

>d3wtvc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvipaaalagytgsgpiqlwqfllelltdkscqsfiswtgdgwefklsdpdevarrwgkr
knkpkmnyeklsrglryyydkniihktagkryvyrfvcdlqsllgytpeelhamldvk

Timeline for d3wtvc_:

• d3wtvc_ is new in SCOPe 2.04-stable
  
• d3wtvc_ appears in SCOPe 2.05
  
• d3wtvc_ appears in the current release, SCOPe 2.08