Lineage for d4u5xa_ (4u5x A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847308Species Oryza sativa [TaxId:39947] [259129] (1 PDB entry)
  8. 1847309Domain d4u5xa_: 4u5x A: [259130]
    automated match to d2yinc_
    complexed with gnp, gol, mg

Details for d4u5xa_

PDB Entry: 4u5x (more details), 1.9 Å

PDB Description: Structure of plant small GTPase OsRac1 complexed with the non-hydrolyzable GTP analog GMPPNP
PDB Compounds: (A:) Rac-like GTP-binding protein 1

SCOPe Domain Sequences for d4u5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u5xa_ c.37.1.8 (A:) automated matches {Oryza sativa [TaxId: 39947]}
gstrfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvsvdgsvvnlglwdt
agledysrlrplsyrgadvfilsfslisrasyenvqkkwmpelrrfapgvpvvlvgtkld
lredrayladhpassiitteqgeelrkligavayiecssktqrnikavfdtaikvvlq

SCOPe Domain Coordinates for d4u5xa_:

Click to download the PDB-style file with coordinates for d4u5xa_.
(The format of our PDB-style files is described here.)

Timeline for d4u5xa_: