SCOPe 2.04: Domain d4u5xa_: 4u5x A:

Lineage for d4u5xa_ (4u5x A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (24 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [259129] (1 PDB entry)

8. Domain d4u5xa_: 4u5x A: [259130]
   automated match to d2yinc_
   complexed with gnp, gol, mg

Details for d4u5xa_

PDB Entry: 4u5x, 1.9 Å

PDB Description: structure of plant small gtpase osrac1 complexed with the non- hydrolyzable gtp analog gmppnp

PDB Compounds: (A:) Rac-like GTP-binding protein 1

SCOPe Domain Sequences for d4u5xa_:

Sequence; same for both SEQRES and ATOM records:

>d4u5xa_ c.37.1.8 (A:) automated matches {Oryza sativa [TaxId: 39947]}
gstrfikcvtvgdgavgktcmlicytsnkfptdyiptvfdnfsanvsvdgsvvnlglwdt
agledysrlrplsyrgadvfilsfslisrasyenvqkkwmpelrrfapgvpvvlvgtkld
lredrayladhpassiitteqgeelrkligavayiecssktqrnikavfdtaikvvlq

Timeline for d4u5xa_:

• d4u5xa_ is new in SCOPe 2.04-stable
  
• d4u5xa_ appears in SCOPe 2.05
  
• d4u5xa_ appears in the current release, SCOPe 2.08, called d4u5xa1