Lineage for d2btce_ (2btc E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d2btce_: 2btc E: [25913]
Other proteins in same PDB: d2btci_
Details for d2btce_
PDB Entry: 2btc (more details), 1.5 Å
PDB Description: bovine trypsin in complex with squash seed inhibitor (cucurbita pepo trypsin inhibitor ii)
SCOP Domain Sequences for d2btce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btce_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d2btce_:
Click to download the PDB-style file with coordinates for d2btce_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2btce_:
- d2btce_ appears in SCOP 1.57
- d2btce_ appears in the current release, SCOPe 2.08
View in 3D
